PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067165001
Common NameGSBRNA2T00067165001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 479aa    MW: 54269.2 Da    PI: 7.0687
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067165001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.2e-103243611954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00067165001 324 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 361
                          665559******************************88 PP

2BELL119.91.1e-38187258172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          er+elq+kk kLl++++eVdkrY+qy++q+++++ssFe+vag+g+akpYts+Al++iSrhFr+L+dai+eq+
  GSBRNA2T00067165001 187 ERHELQSKKHKLLTMVDEVDKRYNQYYHQMEALASSFEMVAGVGAAKPYTSVALNRISRHFRNLRDAIKEQV 258
                          79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.8E-49128256IPR006563POX domain
PfamPF075269.5E-46134254IPR006563POX domain
PROSITE profilePS5007112.422302365IPR001356Homeobox domain
CDDcd000861.76E-11305366No hitNo description
SMARTSM003896.5E-10305369IPR001356Homeobox domain
SuperFamilySSF466897.27E-18306373IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28308371IPR009057Homeodomain-like
PfamPF059205.8E-18322361IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MAVYYPTSTV GMQSLYQEPI YLNEQASSSS AASFSGAGAG ANCLEIPNSV PNEMVFIPPT  60
SDTSLNGNVT VSSNDLSFHG GGLSLSLGNQ IQYHYQNLSN QLSYNEENGK SHHHQHHHQV  120
PSFGFYNNGF VSSVLRSRYL KPTQQLLDEV VSVKKTKNNE KGQDFTNGSK PNDTNNTVNN  180
EELSPSERHE LQSKKHKLLT MVDEVDKRYN QYYHQMEALA SSFEMVAGVG AAKPYTSVAL  240
NRISRHFRNL RDAIKEQVQV IRGKLGEKET AEEQGERIPR LRYLDQRLRQ QRALHQQLGM  300
VRPTWRPQRG LPENSVSILR AWLFEHFLHP YPKESEKIML AKQTGLSKNQ VANWFINARV  360
RLWKPMIEEM YKEEFGDSPE LLSNSNQDSS NNKKNRMNET SQLKHEDTSS SSQQQNHGNN  420
NIPYTSDAEE NLIFADPKPD SLMNYNGFGV VDYNGYIGLG NQQDGRFSNP HQLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16311369563Homeobox protein Meis2
3k2a_B3e-16311369563Homeobox protein Meis2
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00067165001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128100.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_009128099.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078HN930.0A0A078HN93_BRANA; BnaA02g17200D protein
STRINGBra008197.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]